PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_14900V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 335aa    MW: 36888.5 Da    PI: 8.1427
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_14900V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.19.6e-2872122151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         k+ien + rqvtfskRr g+lKKA+EL vLCdaeva+iifsstgkl+e++s
  Pp3c14_14900V3.1.p  72 KKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFAS 122
                         68***********************************************86 PP

2K-box95.67.9e-321422311099
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++ ++  + +e+ kL++++e Lq++qRh+lGedL+ L++ +L qLeqqL+ +++++R++Kn+llle++eel++ke++lq +n++Lr+kl+
  Pp3c14_14900V3.1.p 142 TDGNSDFMGREVVKLRQQLERLQHSQRHMLGEDLQVLTVPDLLQLEQQLDMGVSRVRARKNQLLLEEVEELRRKEHDLQAANEELRQKLA 231
                         566788999*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.01164124IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-4264123IPR002100Transcription factor, MADS-box
CDDcd002652.16E-4565139No hitNo description
SuperFamilySSF554559.94E-3465152IPR002100Transcription factor, MADS-box
PROSITE patternPS00350066120IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-306686IPR002100Transcription factor, MADS-box
PfamPF003198.1E-2673120IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-3086101IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-30101122IPR002100Transcription factor, MADS-box
PfamPF014863.8E-28145230IPR002487Transcription factor, K-box
PROSITE profilePS5129716.476146236IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010094Biological Processspecification of carpel identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MMTVSGQNKS LCFSLSLNSS NRGSLELLGR GVDSSSGGRD AVTADSSSPG VGKEDPPKER  60
EVVMGRGKIE IKKIENPTSR QVTFSKRRGG LLKKAHELAV LCDAEVALII FSSTGKLFEF  120
ASSGSMRDIL ERYSKCPDGV QTDGNSDFMG REVVKLRQQL ERLQHSQRHM LGEDLQVLTV  180
PDLLQLEQQL DMGVSRVRAR KNQLLLEEVE ELRRKEHDLQ AANEELRQKL ADAKGMLTLE  240
AGTARAGTSE SPGDQGGSWP TREVGGITQH QAITTFPAHL NLRDPQTSQT SLHLGLFPKS  300
HMPSASRRPS QQSPTEPEGE SSMRWEHPHF RSQK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J7e-2065149184Myocyte-specific enhancer factor 2A
3p57_I7e-2065149184Myocyte-specific enhancer factor 2A
3p57_D7e-2065149184Myocyte-specific enhancer factor 2A
3p57_C7e-2065149184Myocyte-specific enhancer factor 2A
3p57_B7e-2065149184Myocyte-specific enhancer factor 2A
3p57_A7e-2065149184Myocyte-specific enhancer factor 2A
3kov_J7e-2065149184Myocyte-specific enhancer factor 2A
3kov_I7e-2065149184Myocyte-specific enhancer factor 2A
3kov_B7e-2065149184Myocyte-specific enhancer factor 2A
3kov_A7e-2065149184Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0777134e-95EF077713.1 Physcomitrella patens MADS-domain transcription factor (PPMC5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001776709.10.0MIKCC MADS-domain protein PPMC6
TrEMBLA9TDM30.0A9TDM3_PHYPA; MIKCC MADS-domain protein PPMC6
STRINGPP1S209_130V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.12e-53MIKC_MADS family protein